PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa012107
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family LBD
Protein Properties Length: 188aa    MW: 20666.2 Da    PI: 5.1583
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58673790PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260130.66.9e-41301291100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +CaaCk+lrr+Ca+ Cvlap+fp ++p kf ++h++FG sn++k+l++lpe++r da+ss+vyeA+ar+rdP yG++g i++lq+q+++l+a+la++++e
  Lsa012107  30 PCAACKILRRRCAETCVLAPHFPPDEPLKFIMAHRVFGSSNIIKFLQELPESQRGDAVSSMVYEANARIRDPAYGSAGAIFQLQNQVNELQAQLAKAQAE 129
                7***********************************************************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.95329130IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-4030127IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MASHHANDTL QPKLSSPSTS SLPMSVVVTP CAACKILRRR CAETCVLAPH FPPDEPLKFI  60
MAHRVFGSSN IIKFLQELPE SQRGDAVSSM VYEANARIRD PAYGSAGAIF QLQNQVNELQ  120
AQLAKAQAEV FNIQCQYAAL FCIETGQSPQ SSSHQSFDGF VTGSDESFQS SNLSFYLDQD  180
SLWDTIWA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014497455.18e-76PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR02e-64LBD1_ARATH; LOB domain-containing protein 1
SwissprotQ9SK086e-64LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A103YF146e-97A0A103YF14_CYNCS; Lateral organ boundaries domain-containing protein
STRINGPGSC0003DMT4000194104e-74(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.14e-56LOB domain-containing protein 11